(data stored in ACNUC7421 zone)

EMBL: CP000462.PE566

CP000462.PE566       Location/Qualifiers
FT   CDS             623853..626321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0590"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase II (akii-hdii)"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF00742; match to protein
FT                   family HMM PF03447; match to protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39637"
FT                   /db_xref="GOA:A0KFU7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU7"
FT                   /protein_id="ABK39637.1"
FT                   /translation="MEQQQQGEIAVATEAGLKRRHVHKFGGSSLADPVCYRRVASILEQ
FT                   QAEQQGGGRELVVVSAAGKTTNRLIQLVELAEAGDEAAGEAISALQAYQQSLIDGLLEG
FT                   ELHLELSQQLADDMQLIAKTLEGQFDRFERNGLLAFGEVWSARLLAALLTSRGDKAIWL
FT                   DARSFLRAEDGALVKVDTALSSELLKARLAEHAGRIVVTGFIAADMEGRSLLLGRNGSD
FT                   YSASLLALLADGESTTIWSDVAGVYSADPRRVKEARLLERLSLAEANELARLGSSVLHS
FT                   RTLQPVADSRQRLTLRCSYNPDEGCTHILRRAPRSGGARIVSSVDQIALIELKVLPQTH
FT                   YEQTVAAIEAHLARHRLNPLTLQRQPDRRILRLAYTLEVAQGAFELLRDFQLQGSFTGL
FT                   IQREGYSLVALVGAGVTDNAEQCHRFYQLLADQPLEFVQVAKDGLSLVAVLRQVVLEPL
FT                   LIALHSALFSRPNRVGLVVFGKGNIGGHWLNLYAREKARLEHELNLALTLYGVFSSEGG
FT                   LLDEEGLDPLKVQDNFNPKPLIWPELLAQLEQHGFDTLIALDMTASETVSRYYPDFAQL
FT                   GIHIIAANKFAGAADSEFYQRIKQTCRDHQVQWRYNATVGAGLPIQSSIQMLRQSGDRI
FT                   QGVSGIFSGTLSWLFQQYDGSRPFSELVDEAWQHGLTEPDPREDLSGQDVRRKLLILAR
FT                   EAGFELDSADIELENLVPVSLRKVSTDQFMDRLKDLDDPIQTAFEGARRVGKVLRYVAR
FT                   FEHDGKARVGLEALEPHHPFANLLPCDNIFAIESDSYRTNPLVIQGPGAGREVTAAAIQ
FT                   YDLWQICASL"
     MEQQQQGEIA VATEAGLKRR HVHKFGGSSL ADPVCYRRVA SILEQQAEQQ GGGRELVVVS        60
     AAGKTTNRLI QLVELAEAGD EAAGEAISAL QAYQQSLIDG LLEGELHLEL SQQLADDMQL       120
     IAKTLEGQFD RFERNGLLAF GEVWSARLLA ALLTSRGDKA IWLDARSFLR AEDGALVKVD       180
     TALSSELLKA RLAEHAGRIV VTGFIAADME GRSLLLGRNG SDYSASLLAL LADGESTTIW       240
     SDVAGVYSAD PRRVKEARLL ERLSLAEANE LARLGSSVLH SRTLQPVADS RQRLTLRCSY       300
     NPDEGCTHIL RRAPRSGGAR IVSSVDQIAL IELKVLPQTH YEQTVAAIEA HLARHRLNPL       360
     TLQRQPDRRI LRLAYTLEVA QGAFELLRDF QLQGSFTGLI QREGYSLVAL VGAGVTDNAE       420
     QCHRFYQLLA DQPLEFVQVA KDGLSLVAVL RQVVLEPLLI ALHSALFSRP NRVGLVVFGK       480
     GNIGGHWLNL YAREKARLEH ELNLALTLYG VFSSEGGLLD EEGLDPLKVQ DNFNPKPLIW       540
     PELLAQLEQH GFDTLIALDM TASETVSRYY PDFAQLGIHI IAANKFAGAA DSEFYQRIKQ       600
     TCRDHQVQWR YNATVGAGLP IQSSIQMLRQ SGDRIQGVSG IFSGTLSWLF QQYDGSRPFS       660
     ELVDEAWQHG LTEPDPREDL SGQDVRRKLL ILAREAGFEL DSADIELENL VPVSLRKVST       720
     DQFMDRLKDL DDPIQTAFEG ARRVGKVLRY VARFEHDGKA RVGLEALEPH HPFANLLPCD       780
     NIFAIESDSY RTNPLVIQGP GAGREVTAAA IQYDLWQICA SL                          822
//

If you have problems or comments...

PBIL Back to PBIL home page