(data stored in ACNUC7421 zone)

EMBL: CP000462.PE577

CP000462.PE577       Location/Qualifiers
FT   CDS             complement(639428..639769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0601"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF06961"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39232"
FT                   /db_xref="GOA:A0KFV8"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV8"
FT                   /protein_id="ABK39232.1"
FT                   /translation="MIWLALLPLLWTAWLGLADANWWPLAIVTTMSLLTVLAYAHDKRQ
FT                   AIRGGWRIPESRLHLLELFGGWPGALVARHWLRHKTQKGSYRRVFWFIVLLHLTLWGLW
FT                   LGRPLWQTI"
     MIWLALLPLL WTAWLGLADA NWWPLAIVTT MSLLTVLAYA HDKRQAIRGG WRIPESRLHL        60
     LELFGGWPGA LVARHWLRHK TQKGSYRRVF WFIVLLHLTL WGLWLGRPLW QTI              113
//

If you have problems or comments...

PBIL Back to PBIL home page