(data stored in ACNUC7421 zone)

EMBL: CP000462.PE578

CP000462.PE578       Location/Qualifiers
FT   CDS             complement(639766..640356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0602"
FT                   /product="maltose O-acetyltransferase"
FT                   /EC_number="2.3.1.79"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36537"
FT                   /db_xref="GOA:A0KFV9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFV9"
FT                   /protein_id="ABK36537.1"
FT                   /translation="MASDWDKVLAGGALDSQSEEIANDRIRGQALLAQLNASPAGDEAL
FT                   RQRLCGELFGHCPDSCWISTPFTCEFGRNIHIGEKTFFNFNITILDVGEVHIGSHVLLA
FT                   PNVQIYTATHTMDYLERRNWTAYNKPVRIGDDCWIGGGAIICPGVTIGPRSIIGAGAVI
FT                   TRDIPADSVAVGNPARVIRSLSPDAPRGWELAL"
     MASDWDKVLA GGALDSQSEE IANDRIRGQA LLAQLNASPA GDEALRQRLC GELFGHCPDS        60
     CWISTPFTCE FGRNIHIGEK TFFNFNITIL DVGEVHIGSH VLLAPNVQIY TATHTMDYLE       120
     RRNWTAYNKP VRIGDDCWIG GGAIICPGVT IGPRSIIGAG AVITRDIPAD SVAVGNPARV       180
     IRSLSPDAPR GWELAL                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page