(data stored in ACNUC7421 zone)

EMBL: CP000462.PE587

CP000462.PE587       Location/Qualifiers
FT   CDS             complement(649679..651376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0611"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39381"
FT                   /db_xref="GOA:A0KFW8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW8"
FT                   /protein_id="ABK39381.1"
FT                   /translation="MFKLGDIAVSRKLMLLLSLALIGFIALLLISASALHRNLMSEREA
FT                   RLQAVLDLAMSRIQTLAATLPAPQAQAEAKAMLNSMRFDGDNYLFVLDENRRMVVHPVR
FT                   PELVGQQMGESGTATAGVHWQQMVDLGKGGHSGRLEYKWISPSGEAAQKMSLVAGYQPW
FT                   GWILGSGVLLQDIQATIWSQYQLMGGATLLVTLLMGLLGFAISRSIVNPLAEINRAMQQ
FT                   VAAGDLVVSIPVHGQDELGAVASCTNQGLNAIRRALLEASQGARNVADAALRIAASAEQ
FT                   TNQAVNSQRDQLAQLATAMNEMSATISDVAGHAENTARDTQDATSEAGLGNRDVHASVH
FT                   GIQALATEVEQATLQVNQLKEGVMQISEVTAVISAISEQTNLLALNAAIEAARAGEQGR
FT                   GFAVVADEVRQLASRTRQSTEEIQSTIAQLQQRAVTAASAMDASRKLAESSVSQSEKAG
FT                   QDLSLIVNHIQHVSDMATQIATAAEQQSMVAEDMNRNVSGINDSALEMSQSASQLARES
FT                   ELLAGLSRSLDERLAVFKLGSAIDQQLEQRLAPLHRQVSPAERPRVRH"
     MFKLGDIAVS RKLMLLLSLA LIGFIALLLI SASALHRNLM SEREARLQAV LDLAMSRIQT        60
     LAATLPAPQA QAEAKAMLNS MRFDGDNYLF VLDENRRMVV HPVRPELVGQ QMGESGTATA       120
     GVHWQQMVDL GKGGHSGRLE YKWISPSGEA AQKMSLVAGY QPWGWILGSG VLLQDIQATI       180
     WSQYQLMGGA TLLVTLLMGL LGFAISRSIV NPLAEINRAM QQVAAGDLVV SIPVHGQDEL       240
     GAVASCTNQG LNAIRRALLE ASQGARNVAD AALRIAASAE QTNQAVNSQR DQLAQLATAM       300
     NEMSATISDV AGHAENTARD TQDATSEAGL GNRDVHASVH GIQALATEVE QATLQVNQLK       360
     EGVMQISEVT AVISAISEQT NLLALNAAIE AARAGEQGRG FAVVADEVRQ LASRTRQSTE       420
     EIQSTIAQLQ QRAVTAASAM DASRKLAESS VSQSEKAGQD LSLIVNHIQH VSDMATQIAT       480
     AAEQQSMVAE DMNRNVSGIN DSALEMSQSA SQLARESELL AGLSRSLDER LAVFKLGSAI       540
     DQQLEQRLAP LHRQVSPAER PRVRH                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page