(data stored in ACNUC7421 zone)

EMBL: CP000462.PE588

CP000462.PE588       Location/Qualifiers
FT   CDS             651672..653519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0612"
FT                   /product="oligoendopeptidase F"
FT                   /note="identified by match to protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37892"
FT                   /db_xref="GOA:A0KFW9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFW9"
FT                   /protein_id="ABK37892.1"
FT                   /translation="MSSIARNYLNQLNADYLQVHRRKEDLFWSTYMGTSDDQAGFTAAE
FT                   QAYKAFCADPARLPVLRQMQAQAEETELKRGLGGWIAFFECNVIEDPQAAALMDELVAA
FT                   EAALFARRRELKLTLLDEQGRQVAGSLPAASTALAASSDEAVRQSALAMFHTLEQWVVD
FT                   NGYLAIVALRNRFARAMGYRDYFDYKVHKNEQMSPAQLFAILDDFIAGTEQRLHQSLAE
FT                   LKAAKGEAALLPHNLRYSVSGDVTRQLDPYVPFSRALQDWVESFRRLGIQYRGATLTLD
FT                   LLTREGKYENGFCHGPVPSFWQEGEWVPAVVNFTSLANPAQVGSGWSGLNTLFHEGGHA
FT                   AHFANVTGNAPCFSQEFPPTSMAYAETQSMFCDSLLDDADWLKRYARNAAGEPIPDALI
FT                   KAMIEARQPFRAFNERQIALVAYFERDLYAMDEAERTPAAVLVLARRWERKILGGESPR
FT                   PLLAIPHLLNQESACAYHGYLLALMAVEQTRAYFLKRDGYLTDNPRIGPDLAAHYWGPG
FT                   NGMTHDETLQSLTGKGFSAGPLARACNQSVAEAWQQAEACMAAARQRPPVGEGEPLNAR
FT                   IRVVHGDQLIADNSGSEAAMLADFECWIRDHYQETVTSH"
     MSSIARNYLN QLNADYLQVH RRKEDLFWST YMGTSDDQAG FTAAEQAYKA FCADPARLPV        60
     LRQMQAQAEE TELKRGLGGW IAFFECNVIE DPQAAALMDE LVAAEAALFA RRRELKLTLL       120
     DEQGRQVAGS LPAASTALAA SSDEAVRQSA LAMFHTLEQW VVDNGYLAIV ALRNRFARAM       180
     GYRDYFDYKV HKNEQMSPAQ LFAILDDFIA GTEQRLHQSL AELKAAKGEA ALLPHNLRYS       240
     VSGDVTRQLD PYVPFSRALQ DWVESFRRLG IQYRGATLTL DLLTREGKYE NGFCHGPVPS       300
     FWQEGEWVPA VVNFTSLANP AQVGSGWSGL NTLFHEGGHA AHFANVTGNA PCFSQEFPPT       360
     SMAYAETQSM FCDSLLDDAD WLKRYARNAA GEPIPDALIK AMIEARQPFR AFNERQIALV       420
     AYFERDLYAM DEAERTPAAV LVLARRWERK ILGGESPRPL LAIPHLLNQE SACAYHGYLL       480
     ALMAVEQTRA YFLKRDGYLT DNPRIGPDLA AHYWGPGNGM THDETLQSLT GKGFSAGPLA       540
     RACNQSVAEA WQQAEACMAA ARQRPPVGEG EPLNARIRVV HGDQLIADNS GSEAAMLADF       600
     ECWIRDHYQE TVTSH                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page