(data stored in ACNUC7421 zone)

EMBL: CP000462.PE591

CP000462.PE591       Location/Qualifiers
FT   CDS             656878..657588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38761"
FT                   /db_xref="GOA:A0KFX2"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX2"
FT                   /protein_id="ABK38761.1"
FT                   /translation="MNAIHCFIRIVFDWSISMKRAKWKPWLGLGALLAGVIGWYLWPQG
FT                   VAPGQAAGDEERAADSGPLAELTPLAAMPAPALKPAPIAAPAKPDRLREDGSQQLETPW
FT                   QAAEVDADFPLAEPGDAVEQPQPIALQGSDLERAQVGDSVALPMPDGSTLQARVTKVEL
FT                   QRGGERNWQGEIRVDGDSYPVNFTVGKQATFGFIGTPQGSYSVETLGGKGWVYKNPPLD
FT                   LGHGGDDALIPTHQ"
     MNAIHCFIRI VFDWSISMKR AKWKPWLGLG ALLAGVIGWY LWPQGVAPGQ AAGDEERAAD        60
     SGPLAELTPL AAMPAPALKP APIAAPAKPD RLREDGSQQL ETPWQAAEVD ADFPLAEPGD       120
     AVEQPQPIAL QGSDLERAQV GDSVALPMPD GSTLQARVTK VELQRGGERN WQGEIRVDGD       180
     SYPVNFTVGK QATFGFIGTP QGSYSVETLG GKGWVYKNPP LDLGHGGDDA LIPTHQ           236
//

If you have problems or comments...

PBIL Back to PBIL home page