(data stored in ACNUC7421 zone)

EMBL: CP000462.PE593

CP000462.PE593       Location/Qualifiers
FT   CDS             complement(659059..662220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0617"
FT                   /product="putative Tricorn protease homolog 1"
FT                   /note="identified by match to protein family HMM PF03572;
FT                   match to protein family HMM PF07676"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37984"
FT                   /db_xref="GOA:A0KFX4"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR012393"
FT                   /db_xref="InterPro:IPR028204"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX4"
FT                   /protein_id="ABK37984.1"
FT                   /translation="MRYRLSLLLLLLCSSLQAAEPLWLREPALSPDGKQLAFTWQGRVY
FT                   LSAGDGGPAVPLTDGNYLSQRPLWSPDGKLIAFAANLYGNEDVFVVPSHGGEMVRLTRD
FT                   SRPDLPQAFSADGKQLLLSSQRLTDPDADHFVAEGYQAGNLYWTPVAGGPLTPAQPLPA
FT                   TLARPHGSQLAYQMPGMDQPFRKHQHSFAVSRLWLFDGKQHRQLTEDRVAASDPVWDEQ
FT                   GKQLYYLSERSGDFNVWQRDLASGQDRQLTHFKGHPVRGLSASRQGDLVWSWQGELYRL
FT                   DAGSDTPRKLVIQPLFAKVPAEQSWQPGPIDEAIARQDGEEVILVSQGDLYAVDTRRER
FT                   VRQLTRHPSEQSAPRYLDKEQELIYLSEQEGPAALYRLKKGQPDKLFSDPGPLTEEKLL
FT                   AIPGAAISVPTLSPDGKQLAFVVDGQAVHLLDLASGKQRQLVAAEFNPSRHAVELAFAP
FT                   DSRHLALTIQPDSAQQEIAVIDTRDAKAKPVNVSLNGYRDGEPAWSQDGGILYWQSTKY
FT                   GVLGADGEPLGGSLLGLYSSRAAKSDFIAEQAPPKAGYGFEADRLAHREAIQLQPEGPI
FT                   LASRIVDDHLIYLVEVMDANGESEIKGYAQDLRKGETKLLFAEQPGPALASLNQDASLA
FT                   TLVREGEIALIDTRSGEASSHPFNLLITASWQDRMSAAFDQITRLTRDEFYRADMNGVD
FT                   WDGYVAAYRRLLPGISNDRDFGNLLAELAGELNVSHTWGSGPAPSLRMPDETASLGGYW
FT                   RERQGAVELDALLAGGPLEQETDLAPGARLLAVNGTELHSLNELDALLNHQAGQRLALT
FT                   VLPKGAKEPSQLEVTAIDLQQEYQLQLDGWIAKRRSQVEQLSQGRVGYVYLPEMSSAVY
FT                   EEVVADALGRQRNREALIVDVRFNKGGYLANTLVEFLTGSGSAQGMARSWPRLGKGETD
FT                   AATRQWTKPSVVLVNAGSYSEGSAFPQYYRTLKVGPIVGEPVPGTGTMVYAHTSRLIPG
FT                   LAYGIPTLGLRNPDGTLYENQELIPDVQVVLTPADMLAGRDPQLAAAVQAALAQLTTNA
FT                   KPAAK"
     MRYRLSLLLL LLCSSLQAAE PLWLREPALS PDGKQLAFTW QGRVYLSAGD GGPAVPLTDG        60
     NYLSQRPLWS PDGKLIAFAA NLYGNEDVFV VPSHGGEMVR LTRDSRPDLP QAFSADGKQL       120
     LLSSQRLTDP DADHFVAEGY QAGNLYWTPV AGGPLTPAQP LPATLARPHG SQLAYQMPGM       180
     DQPFRKHQHS FAVSRLWLFD GKQHRQLTED RVAASDPVWD EQGKQLYYLS ERSGDFNVWQ       240
     RDLASGQDRQ LTHFKGHPVR GLSASRQGDL VWSWQGELYR LDAGSDTPRK LVIQPLFAKV       300
     PAEQSWQPGP IDEAIARQDG EEVILVSQGD LYAVDTRRER VRQLTRHPSE QSAPRYLDKE       360
     QELIYLSEQE GPAALYRLKK GQPDKLFSDP GPLTEEKLLA IPGAAISVPT LSPDGKQLAF       420
     VVDGQAVHLL DLASGKQRQL VAAEFNPSRH AVELAFAPDS RHLALTIQPD SAQQEIAVID       480
     TRDAKAKPVN VSLNGYRDGE PAWSQDGGIL YWQSTKYGVL GADGEPLGGS LLGLYSSRAA       540
     KSDFIAEQAP PKAGYGFEAD RLAHREAIQL QPEGPILASR IVDDHLIYLV EVMDANGESE       600
     IKGYAQDLRK GETKLLFAEQ PGPALASLNQ DASLATLVRE GEIALIDTRS GEASSHPFNL       660
     LITASWQDRM SAAFDQITRL TRDEFYRADM NGVDWDGYVA AYRRLLPGIS NDRDFGNLLA       720
     ELAGELNVSH TWGSGPAPSL RMPDETASLG GYWRERQGAV ELDALLAGGP LEQETDLAPG       780
     ARLLAVNGTE LHSLNELDAL LNHQAGQRLA LTVLPKGAKE PSQLEVTAID LQQEYQLQLD       840
     GWIAKRRSQV EQLSQGRVGY VYLPEMSSAV YEEVVADALG RQRNREALIV DVRFNKGGYL       900
     ANTLVEFLTG SGSAQGMARS WPRLGKGETD AATRQWTKPS VVLVNAGSYS EGSAFPQYYR       960
     TLKVGPIVGE PVPGTGTMVY AHTSRLIPGL AYGIPTLGLR NPDGTLYENQ ELIPDVQVVL      1020
     TPADMLAGRD PQLAAAVQAA LAQLTTNAKP AAK                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page