(data stored in ACNUC7421 zone)

EMBL: CP000462.PE594

CP000462.PE594       Location/Qualifiers
FT   CDS             662465..662956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0618"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38290"
FT                   /db_xref="GOA:A0KFX5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX5"
FT                   /protein_id="ABK38290.1"
FT                   /translation="MPRDGMRAVLLCLLGLWPALSFATLSADMVVVKKSSYSLTLMKDG
FT                   KEVKRYWIALGPAPKGHKQREGDQRTPEGRYILDYKKTNSNYYKAIHINYPNLDDIKAA
FT                   NEMGVRPGGMIMIHGQRNSIGNTRLQPSNWTNGCIAMLNKDLDEVWNAIEPGTPIVIQP
FT                   "
     MPRDGMRAVL LCLLGLWPAL SFATLSADMV VVKKSSYSLT LMKDGKEVKR YWIALGPAPK        60
     GHKQREGDQR TPEGRYILDY KKTNSNYYKA IHINYPNLDD IKAANEMGVR PGGMIMIHGQ       120
     RNSIGNTRLQ PSNWTNGCIA MLNKDLDEVW NAIEPGTPIV IQP                         163
//

If you have problems or comments...

PBIL Back to PBIL home page