(data stored in ACNUC7421 zone)

EMBL: CP000462.PE596

CP000462.PE596       Location/Qualifiers
FT   CDS             664285..665811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38585"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX7"
FT                   /protein_id="ABK38585.1"
FT                   /translation="MSFTETCQRIVRDPLLSPAQKSHALALAAENALPYPELPAEVSEA
FT                   MAKGFVCDMFEGHAPYKPRYVLPDYEKFLRQGSAWLELAPPQDFDEALDALRILYHHVP
FT                   SVTGMPVWLGRLDHLLLPFVGELDDEALYRKLKGFWIYLDRVLPDAFMHVNIGPDDNRL
FT                   CRLILRIDGDLKQVAPNLTLFHDPAQTPDSLLLQGVKNIAACSKPHIANYPLHRNTFDE
FT                   RGFGIVSCYNALPQAGGANTLVRVSLKRVAEQAHGIDDFLGCLLPHYCRLASRLIEARA
FT                   AFLHQESGFFDSFLVQEGLLEEDRFVPMFGIYGMAEAVNLLMDKENLPERYGRDEEANQ
FT                   LGYRISAQLARHVSEAPQVHAWGGRALLHSQGGLSVDRGVTPGVRIPYGEEPDPASHML
FT                   ALAPHHGFYHSGISEILTLDPTIRQNPQALLQLCKGALAIGMREFTANVADSDLVRVTG
FT                   YMIRKSDVARFATEGSRLQTTCLGAEASELTGIRQRAPRVVGREATLCDY"
     MSFTETCQRI VRDPLLSPAQ KSHALALAAE NALPYPELPA EVSEAMAKGF VCDMFEGHAP        60
     YKPRYVLPDY EKFLRQGSAW LELAPPQDFD EALDALRILY HHVPSVTGMP VWLGRLDHLL       120
     LPFVGELDDE ALYRKLKGFW IYLDRVLPDA FMHVNIGPDD NRLCRLILRI DGDLKQVAPN       180
     LTLFHDPAQT PDSLLLQGVK NIAACSKPHI ANYPLHRNTF DERGFGIVSC YNALPQAGGA       240
     NTLVRVSLKR VAEQAHGIDD FLGCLLPHYC RLASRLIEAR AAFLHQESGF FDSFLVQEGL       300
     LEEDRFVPMF GIYGMAEAVN LLMDKENLPE RYGRDEEANQ LGYRISAQLA RHVSEAPQVH       360
     AWGGRALLHS QGGLSVDRGV TPGVRIPYGE EPDPASHMLA LAPHHGFYHS GISEILTLDP       420
     TIRQNPQALL QLCKGALAIG MREFTANVAD SDLVRVTGYM IRKSDVARFA TEGSRLQTTC       480
     LGAEASELTG IRQRAPRVVG REATLCDY                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page