(data stored in ACNUC7421 zone)

EMBL: CP000462.PE597

CP000462.PE597       Location/Qualifiers
FT   CDS             665849..666700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0621"
FT                   /product="pyruvate formate lyase activating enzyme"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38013"
FT                   /db_xref="GOA:A0KFX8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX8"
FT                   /protein_id="ABK38013.1"
FT                   /translation="MSRWLPFSCVDGPGNRLVLFLQGCNFACPGCHNPHTIGLCDHCGD
FT                   CVPGCPSGALTLHEGRVSWQAARCTDCDACLDLCPRSASPKTAAMTVAEVLALLRRYGP
FT                   LLSGITVSGGEATTQLPFVIALFTAIKGAADLAHLDCLLDSNGSLAEAGWQRLLPVLDG
FT                   AMIDLKGWGDSVHHMLAGYGRERVLASLQLLAQAGKLAEVRLLQVPGQSDYLVADGTLE
FT                   GGLAAFLRALGPVPIRLNGFRHHGVRGAAQGWPEATREELEQLAAALAVAGLGPVSLPP
FT                   LL"
     MSRWLPFSCV DGPGNRLVLF LQGCNFACPG CHNPHTIGLC DHCGDCVPGC PSGALTLHEG        60
     RVSWQAARCT DCDACLDLCP RSASPKTAAM TVAEVLALLR RYGPLLSGIT VSGGEATTQL       120
     PFVIALFTAI KGAADLAHLD CLLDSNGSLA EAGWQRLLPV LDGAMIDLKG WGDSVHHMLA       180
     GYGRERVLAS LQLLAQAGKL AEVRLLQVPG QSDYLVADGT LEGGLAAFLR ALGPVPIRLN       240
     GFRHHGVRGA AQGWPEATRE ELEQLAAALA VAGLGPVSLP PLL                         283
//

If you have problems or comments...

PBIL Back to PBIL home page