(data stored in ACNUC7421 zone)

EMBL: CP000462.PE598

CP000462.PE598       Location/Qualifiers
FT   CDS             666893..667216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37548"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFX9"
FT                   /protein_id="ABK37548.1"
FT                   /translation="MSESNALYRVQFICHNERYEVYVREVSQGQLFGFIEIANFVWDNH
FT                   TALIVDPSHEKLKSEFADVNRTMIPMHHVLRVDQVRKQGAARITELGNNVSPFPSPIYT
FT                   KKP"
     MSESNALYRV QFICHNERYE VYVREVSQGQ LFGFIEIANF VWDNHTALIV DPSHEKLKSE        60
     FADVNRTMIP MHHVLRVDQV RKQGAARITE LGNNVSPFPS PIYTKKP                     107
//

If you have problems or comments...

PBIL Back to PBIL home page