(data stored in ACNUC7421 zone)

EMBL: CP000462.PE599

CP000462.PE599       Location/Qualifiers
FT   CDS             complement(667259..668182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0623"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37073"
FT                   /db_xref="GOA:A0KFY0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY0"
FT                   /protein_id="ABK37073.1"
FT                   /translation="MDLIALSRLGGRHLVTLHLLLDSQSVTRTAERLCTTPSTVSKTLN
FT                   QLRDLLGDQLLYRQGNQLLLTPFAERLGPTLHRLLSELNGLTGQGGFDPASWQGQLTFA
FT                   LRESGMVWPMGPILAQLMREVPGLVPDIRNKDEQGLAALAAGKLDFVILPHDQSQPLPR
FT                   QQGLVWETLREDKLVCLLRADHPALARSWDLDAYLSWRHIAIRDQELANPFFEQSLAQL
FT                   QVRRQIAAILPDFGSAAALLRQSDLILTAIGGWAEQAAPHALVSRPVPFDYGAVTHSLV
FT                   WYGPAGEEPARRWFRQRILQLARELG"
     MDLIALSRLG GRHLVTLHLL LDSQSVTRTA ERLCTTPSTV SKTLNQLRDL LGDQLLYRQG        60
     NQLLLTPFAE RLGPTLHRLL SELNGLTGQG GFDPASWQGQ LTFALRESGM VWPMGPILAQ       120
     LMREVPGLVP DIRNKDEQGL AALAAGKLDF VILPHDQSQP LPRQQGLVWE TLREDKLVCL       180
     LRADHPALAR SWDLDAYLSW RHIAIRDQEL ANPFFEQSLA QLQVRRQIAA ILPDFGSAAA       240
     LLRQSDLILT AIGGWAEQAA PHALVSRPVP FDYGAVTHSL VWYGPAGEEP ARRWFRQRIL       300
     QLARELG                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page