(data stored in ACNUC7421 zone)

EMBL: CP000462.PE602

CP000462.PE602       Location/Qualifiers
FT   CDS             669956..670915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0626"
FT                   /product="heavy metal transporter"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35911"
FT                   /db_xref="GOA:A0KFY3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY3"
FT                   /protein_id="ABK35911.1"
FT                   /translation="MSSLASSHCHQPVVHEGNPLAEQKTRWAVLLTVIMMVAEIGGGWF
FT                   YNSMALLADGWHMSSHALALGLSVLAYRAARHFARDHRFSFGTWKIEVLGGFTSALLLV
FT                   GVAGMMLFESVFRLLDPSPIHYQQAIVIAIVGLLVNLACAWLLKDDHGHHHGHGHDHHH
FT                   DHHDHAHPHDHGQHHGHQDLNLRAAYIHVLADAATSVLAILALVGGMLWGADWLDPLMG
FT                   IVGAGLVAVWAWGLLRDSGRVLLDAEMDVPLVAEIREVIAELPDAEVRDLHVWRVGQQQ
FT                   YACVLSLLMAAPVAASEIRARLAIHEELVHVTIEVSAA"
     MSSLASSHCH QPVVHEGNPL AEQKTRWAVL LTVIMMVAEI GGGWFYNSMA LLADGWHMSS        60
     HALALGLSVL AYRAARHFAR DHRFSFGTWK IEVLGGFTSA LLLVGVAGMM LFESVFRLLD       120
     PSPIHYQQAI VIAIVGLLVN LACAWLLKDD HGHHHGHGHD HHHDHHDHAH PHDHGQHHGH       180
     QDLNLRAAYI HVLADAATSV LAILALVGGM LWGADWLDPL MGIVGAGLVA VWAWGLLRDS       240
     GRVLLDAEMD VPLVAEIREV IAELPDAEVR DLHVWRVGQQ QYACVLSLLM AAPVAASEIR       300
     ARLAIHEELV HVTIEVSAA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page