(data stored in ACNUC7421 zone)

EMBL: CP000462.PE604

CP000462.PE604       Location/Qualifiers
FT   CDS             671620..675708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0628"
FT                   /product="pullulanase"
FT                   /EC_number="3.2.1.41"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF02922; match to protein
FT                   family HMM TIGR02103"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37551"
FT                   /db_xref="GOA:A0KFY5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR011839"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="InterPro:IPR041111"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY5"
FT                   /protein_id="ABK37551.1"
FT                   /translation="MTGYSDIETNYSGNYKKMDMKKTKVALVTASLLALLSGCNDNSSS
FT                   PSTPDPTDGPVARLPNVQPPAEQLVAGPDQAVIALVDTQTSAARGVTGPFANYSLHLWN
FT                   NDACSATAESGLNAGWDDKVNTPAAADGFGPSWVVPLSKLEGCINFIARNGDLANLTGS
FT                   DMKVVFSDHPDRTVAIVAGKNEIFGSRAEAFTAAFGVAGASAHLIDGNTLIWQGGKDKP
FT                   HVRLYYTESGTIKANAEGVFDFPYITLAPTSLTAEQQAKYPHLKDAAAFALPAGKDLKP
FT                   LLKGELVAIGTDADGILQGATLVQSAGALDALYSEAATKLTYGAVVEGGNVTFRLWAPT
FT                   AKSVKLALFDGQHKPLGERTMTLDEASGSWSVQGGSELVGKFYRYDIQVYHPVSRKLES
FT                   YQVTDPYSLSLAMNSEFSQVVDLNDPALKPEGWDSLKAPHSQQNPADITIYEAHVRDLT
FT                   GNDDSTPAEHRGKFLGLTDTDTAPVKHLQALAKSGVSHLHLLPVFDIATVNEDPAKVAN
FT                   ISDDFGKLCQVNPEVQNSKFAGYCSSGQTIEAVLGDLQGSDSKENPQVQELYGYLRGVD
FT                   SFNWGYDPYHYTTPEGSYATNAEGSQRILEFREMVKAIKQNIGMNVVMDVVYNHTNEAG
FT                   LGPKSVLDKIVPWYYQRLNPETGSVENSTCCSNTAPEHAMFAKLMDDSLVTWARDYKID
FT                   AFRFDLMGHHPKDQMVQALAAVKQVNPEMYFYGEGWNFGEVQDDKRFVQATQKHLAGTG
FT                   IGSFSDRLRDAVRGGSPFDGGDTIRKTQGFGNGALVDANEMDGVDRATALHQADLVRLG
FT                   MAGNLKDFILTDKDGMPKKGSDIDYNGQPAGYAQDPTEIQNYVDKHDNQTLFDNLIYKA
FT                   PQGADLVRMQGVSLATAMLGQGIPFTHAGVELLRSKSMERDSYDSGDWYNRVDYTLADN
FT                   NFDKGLPRKDKDGDNYPLIEKVLGKHVKPSGADMATMVGFYQELAELRQSSRLLRLGSG
FT                   AEVIKRVDFRNTGPDQEPGLIVMTVDDGINAGADLDPAIDGLVVMINATNAPQSISDFR
FT                   DGNDQPIDLTSLQLSPAHHGGESIARDAAANGGTLTLGAWSAAVFVKPQSGAQGTGLPV
FT                   GKKTDLSTVPPFGDTAVYLKGFLNEWGNTNQMTFSSNFMYEFTTEVSSDKLGTTNVKIA
FT                   DASWGPLNYGSCNAGDKLVVGTPLTLCKGGDTGNIGLDLAKAGSYKFVFTAMNKDKPTL
FT                   SVSFTEPVQSCKVLDTVAGNPLGYNLFVKGELSGWAAQPQYQLSYKGMDGDLAIYQAAF
FT                   NYTGSTEFKVANEDWSKEYLLNGGGAVTAETGYAIGFSQPGSANNSITLPQGLWSVLVK
FT                   VDPAGTKAGTAVIQECSAK"
     MTGYSDIETN YSGNYKKMDM KKTKVALVTA SLLALLSGCN DNSSSPSTPD PTDGPVARLP        60
     NVQPPAEQLV AGPDQAVIAL VDTQTSAARG VTGPFANYSL HLWNNDACSA TAESGLNAGW       120
     DDKVNTPAAA DGFGPSWVVP LSKLEGCINF IARNGDLANL TGSDMKVVFS DHPDRTVAIV       180
     AGKNEIFGSR AEAFTAAFGV AGASAHLIDG NTLIWQGGKD KPHVRLYYTE SGTIKANAEG       240
     VFDFPYITLA PTSLTAEQQA KYPHLKDAAA FALPAGKDLK PLLKGELVAI GTDADGILQG       300
     ATLVQSAGAL DALYSEAATK LTYGAVVEGG NVTFRLWAPT AKSVKLALFD GQHKPLGERT       360
     MTLDEASGSW SVQGGSELVG KFYRYDIQVY HPVSRKLESY QVTDPYSLSL AMNSEFSQVV       420
     DLNDPALKPE GWDSLKAPHS QQNPADITIY EAHVRDLTGN DDSTPAEHRG KFLGLTDTDT       480
     APVKHLQALA KSGVSHLHLL PVFDIATVNE DPAKVANISD DFGKLCQVNP EVQNSKFAGY       540
     CSSGQTIEAV LGDLQGSDSK ENPQVQELYG YLRGVDSFNW GYDPYHYTTP EGSYATNAEG       600
     SQRILEFREM VKAIKQNIGM NVVMDVVYNH TNEAGLGPKS VLDKIVPWYY QRLNPETGSV       660
     ENSTCCSNTA PEHAMFAKLM DDSLVTWARD YKIDAFRFDL MGHHPKDQMV QALAAVKQVN       720
     PEMYFYGEGW NFGEVQDDKR FVQATQKHLA GTGIGSFSDR LRDAVRGGSP FDGGDTIRKT       780
     QGFGNGALVD ANEMDGVDRA TALHQADLVR LGMAGNLKDF ILTDKDGMPK KGSDIDYNGQ       840
     PAGYAQDPTE IQNYVDKHDN QTLFDNLIYK APQGADLVRM QGVSLATAML GQGIPFTHAG       900
     VELLRSKSME RDSYDSGDWY NRVDYTLADN NFDKGLPRKD KDGDNYPLIE KVLGKHVKPS       960
     GADMATMVGF YQELAELRQS SRLLRLGSGA EVIKRVDFRN TGPDQEPGLI VMTVDDGINA      1020
     GADLDPAIDG LVVMINATNA PQSISDFRDG NDQPIDLTSL QLSPAHHGGE SIARDAAANG      1080
     GTLTLGAWSA AVFVKPQSGA QGTGLPVGKK TDLSTVPPFG DTAVYLKGFL NEWGNTNQMT      1140
     FSSNFMYEFT TEVSSDKLGT TNVKIADASW GPLNYGSCNA GDKLVVGTPL TLCKGGDTGN      1200
     IGLDLAKAGS YKFVFTAMNK DKPTLSVSFT EPVQSCKVLD TVAGNPLGYN LFVKGELSGW      1260
     AAQPQYQLSY KGMDGDLAIY QAAFNYTGST EFKVANEDWS KEYLLNGGGA VTAETGYAIG      1320
     FSQPGSANNS ITLPQGLWSV LVKVDPAGTK AGTAVIQECS AK                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page