(data stored in ACNUC7421 zone)

EMBL: CP000462.PE607

CP000462.PE607       Location/Qualifiers
FT   CDS             complement(679099..679917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38657"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFY8"
FT                   /protein_id="ABK38657.1"
FT                   /translation="MTRHPSLLLLLLLCLTGLTSLSLSRADTAAAPAAKPVRILNAHLG
FT                   ELPGLINADKTGPFVDLVRAIDDLYPEVSIRITIYPLARAMAGVIAGTADFSLPAIRNL
FT                   QDADLLPYRFSTRSFGKVTHVLYSNTDHLITPDMAYGIVPTKRDLLIEATPGFLPIPLQ
FT                   RSMSIEQSLRKLSRGRIDAFIWAQEEADLMLRQLKLTNIHREHLGDFEDVFIIAKGPTG
FT                   DEVDRFLGEAIERLAASGKLAEIYSRLHRPYVEWQPHPEPLPAKDATKAP"
     MTRHPSLLLL LLLCLTGLTS LSLSRADTAA APAAKPVRIL NAHLGELPGL INADKTGPFV        60
     DLVRAIDDLY PEVSIRITIY PLARAMAGVI AGTADFSLPA IRNLQDADLL PYRFSTRSFG       120
     KVTHVLYSNT DHLITPDMAY GIVPTKRDLL IEATPGFLPI PLQRSMSIEQ SLRKLSRGRI       180
     DAFIWAQEEA DLMLRQLKLT NIHREHLGDF EDVFIIAKGP TGDEVDRFLG EAIERLAASG       240
     KLAEIYSRLH RPYVEWQPHP EPLPAKDATK AP                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page