(data stored in ACNUC7421 zone)

EMBL: CP000462.PE62

CP000462.PE62        Location/Qualifiers
FT   CDS             73217..74872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0066"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF06580; match to protein
FT                   family HMM PF07694"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38252"
FT                   /db_xref="GOA:A0KEB4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB4"
FT                   /protein_id="ABK38252.1"
FT                   /translation="MLLAVFERAALMLMTLFFLTRTRPFQRLFQKRDHTPAELVLVAAI
FT                   FCLFAVFSTYTGIPVEGALINVRIIAIISGGILFGPWVGIPAGVISGLHRYLIDMDGHT
FT                   SIPCLIASIIAGLLATWLHLRCRKSRLWLYGILAGMLCEGLTMLLIWLLTEPHAVGVEI
FT                   VSHIAYPMIAGALCIGLIIKLVQDLDDEKELIAAKQAKLALDIANKTLPFFQNIDRHSL
FT                   SQVCGIIRSEISADAVAITDTRDVLAYVGVGKDYYELDEHHAISDMTQRAVLLDQIIIN
FT                   NDLRQYHLSDFHSVIIIPLRENGSVSGTLKIYYRRTHSITSSLKEMAVGLSQLISTQME
FT                   VSRIEQLKEMTRKAEFTALQSKINPHFLFNALNAISSLIRIRPQQARQLIANLADYLRY
FT                   NLNKGDTLIDIQEELQQVRDYVAIEQARFGDKLEVVFEVDDVHIQVPSLLLQPLVENAI
FT                   LHGIQPRSAPGRVTIEVKQLAGGIRVAVRDTGYGISQAVIDGVAAGRVESRSIGLMNVH
FT                   QRVKLLYGDGLHLKRLEPGTEVSFYLPDQESMPC"
     MLLAVFERAA LMLMTLFFLT RTRPFQRLFQ KRDHTPAELV LVAAIFCLFA VFSTYTGIPV        60
     EGALINVRII AIISGGILFG PWVGIPAGVI SGLHRYLIDM DGHTSIPCLI ASIIAGLLAT       120
     WLHLRCRKSR LWLYGILAGM LCEGLTMLLI WLLTEPHAVG VEIVSHIAYP MIAGALCIGL       180
     IIKLVQDLDD EKELIAAKQA KLALDIANKT LPFFQNIDRH SLSQVCGIIR SEISADAVAI       240
     TDTRDVLAYV GVGKDYYELD EHHAISDMTQ RAVLLDQIII NNDLRQYHLS DFHSVIIIPL       300
     RENGSVSGTL KIYYRRTHSI TSSLKEMAVG LSQLISTQME VSRIEQLKEM TRKAEFTALQ       360
     SKINPHFLFN ALNAISSLIR IRPQQARQLI ANLADYLRYN LNKGDTLIDI QEELQQVRDY       420
     VAIEQARFGD KLEVVFEVDD VHIQVPSLLL QPLVENAILH GIQPRSAPGR VTIEVKQLAG       480
     GIRVAVRDTG YGISQAVIDG VAAGRVESRS IGLMNVHQRV KLLYGDGLHL KRLEPGTEVS       540
     FYLPDQESMP C                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page