(data stored in ACNUC7421 zone)

EMBL: CP000462.PE63

CP000462.PE63        Location/Qualifiers
FT   CDS             75002..75733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0067"
FT                   /product="response regulator receiver domain"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF04397"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38388"
FT                   /db_xref="GOA:A0KEB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB6"
FT                   /protein_id="ABK38388.1"
FT                   /translation="MLKAIIVEDEYLAREELAYLVGQHSTIEIVASFEDGLEAFKYLQD
FT                   HEVDVVFLDIQIPSIDGLLLAKNLHKSSHPPHIVFVTAYKEFAVEAFELEAFDYILKPY
FT                   NEPRLISLLQKLELAGKSQTGQGSEPGTPHNRTVNLVKGERIIVTPCEQIYYAEADEKL
FT                   TYVYTRDDRYVMTMTLSEFVSRLPAEGFFRCHRSYCVNINKIREIVPWFNSTYLIRLHD
FT                   LPFEVPVSRSNIKAFRQLMRL"
     MLKAIIVEDE YLAREELAYL VGQHSTIEIV ASFEDGLEAF KYLQDHEVDV VFLDIQIPSI        60
     DGLLLAKNLH KSSHPPHIVF VTAYKEFAVE AFELEAFDYI LKPYNEPRLI SLLQKLELAG       120
     KSQTGQGSEP GTPHNRTVNL VKGERIIVTP CEQIYYAEAD EKLTYVYTRD DRYVMTMTLS       180
     EFVSRLPAEG FFRCHRSYCV NINKIREIVP WFNSTYLIRL HDLPFEVPVS RSNIKAFRQL       240
     MRL                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page