(data stored in ACNUC7421 zone)

EMBL: CP000462.PE64

CP000462.PE64        Location/Qualifiers
FT   CDS             75855..77033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0068"
FT                   /product="inner membrane protein YhjX"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38455"
FT                   /db_xref="GOA:A0KEB5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB5"
FT                   /protein_id="ABK38455.1"
FT                   /translation="MNRTRYLTLLGTIITQFALGSVYTWSLFNAQLSDKLDEPVSQVAF
FT                   AFGLLSLSLAVASSLAGKLQERFGVRNVTLGAGVLLGIGFFLTAHASNLAMLYLCAGIL
FT                   VGFADGTGYLMTLSNCVKWFPERKGLISACSIGAYGLGSLGFKYINLLLLSSNGLETTF
FT                   QLWGLIAMSMVLVGGMLMKDAPKQAAAVQQSESRDFTLAEAMRKPQYWMLALMFLTACM
FT                   SGLYVIGVAKDIGENMVGLPAVVAANAVAIIAMANLGGRLVLGILSDKMSRIRVITIAQ
FT                   LITLAGMALLLFVPLNANLFFVAVACVAFSFGGTITVYPSLVSDFFGLNNLTKNYGVIY
FT                   LGFGLGSIIGSIVASLFGGFMATFNLILVLLVVALVLSLTIRLPAPVSVERA"
     MNRTRYLTLL GTIITQFALG SVYTWSLFNA QLSDKLDEPV SQVAFAFGLL SLSLAVASSL        60
     AGKLQERFGV RNVTLGAGVL LGIGFFLTAH ASNLAMLYLC AGILVGFADG TGYLMTLSNC       120
     VKWFPERKGL ISACSIGAYG LGSLGFKYIN LLLLSSNGLE TTFQLWGLIA MSMVLVGGML       180
     MKDAPKQAAA VQQSESRDFT LAEAMRKPQY WMLALMFLTA CMSGLYVIGV AKDIGENMVG       240
     LPAVVAANAV AIIAMANLGG RLVLGILSDK MSRIRVITIA QLITLAGMAL LLFVPLNANL       300
     FFVAVACVAF SFGGTITVYP SLVSDFFGLN NLTKNYGVIY LGFGLGSIIG SIVASLFGGF       360
     MATFNLILVL LVVALVLSLT IRLPAPVSVE RA                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page