(data stored in ACNUC7421 zone)

EMBL: CP000462.PE67

CP000462.PE67        Location/Qualifiers
FT   CDS             complement(78800..79102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37283"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE4"
FT                   /protein_id="ABK37283.1"
FT                   /translation="MQTEIRTLLTVITEANLEPTLLRTLTREGLRGYTITDARGRGDHG
FT                   ERNASWSESGNIRLEAICSREQAERLLAHLQSRYYPDYAMVAFLQPVEIVRPEKF"
     MQTEIRTLLT VITEANLEPT LLRTLTREGL RGYTITDARG RGDHGERNAS WSESGNIRLE        60
     AICSREQAER LLAHLQSRYY PDYAMVAFLQ PVEIVRPEKF                             100
//

If you have problems or comments...

PBIL Back to PBIL home page