(data stored in ACNUC7421 zone)

EMBL: CP000462.PE69

CP000462.PE69        Location/Qualifiers
FT   CDS             80145..81047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0073"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39794"
FT                   /db_xref="GOA:A0KEE5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE5"
FT                   /protein_id="ABK39794.1"
FT                   /translation="MLNYKQLYYFWHVARSGSVTRAAEQLHLTPQTVSGQVAELELSLG
FT                   VALFNRVGRRLALTTAGRQALEQAGAIFSLGADLEHTLRHASQELTMQVGIADSVPRTL
FT                   AFELLAPAMALATPLRLVCHEERAEQLFSELASHKLDMVLIDRPLPPDSGVRGYNHELG
FT                   RSPLALFASPELAARARQGFPASLEGLPLLIPGEKSATHDSLLAWYRQQGIHPHLVGQF
FT                   DDSTLMKSFGKAGMGIFPAPLAMADEIARLYGVERIATLAEVTLSYYLVSAGRHLSHPG
FT                   VQAVMEGAKQRLAALGGNK"
     MLNYKQLYYF WHVARSGSVT RAAEQLHLTP QTVSGQVAEL ELSLGVALFN RVGRRLALTT        60
     AGRQALEQAG AIFSLGADLE HTLRHASQEL TMQVGIADSV PRTLAFELLA PAMALATPLR       120
     LVCHEERAEQ LFSELASHKL DMVLIDRPLP PDSGVRGYNH ELGRSPLALF ASPELAARAR       180
     QGFPASLEGL PLLIPGEKSA THDSLLAWYR QQGIHPHLVG QFDDSTLMKS FGKAGMGIFP       240
     APLAMADEIA RLYGVERIAT LAEVTLSYYL VSAGRHLSHP GVQAVMEGAK QRLAALGGNK       300
//

If you have problems or comments...

PBIL Back to PBIL home page