(data stored in ACNUC7421 zone)

EMBL: CP000462.PE7

CP000462.PE7         Location/Qualifiers
FT   CDS             7792..8205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0007"
FT                   /product="16 kDa heat shock protein A"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37772"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA5"
FT                   /protein_id="ABK37772.1"
FT                   /translation="MRSIDFSPLYRSAIGFDRLANLIESAASNGNAGYPPYNIEQLGDS
FT                   DYRISMAVAGFTQEELELSFQENLLTVKGNKQADTERNYLYQGIAERGFERRFQLADYV
FT                   RVKGADLKNGLLHIDLVREVPEAMKPRKIEING"
     MRSIDFSPLY RSAIGFDRLA NLIESAASNG NAGYPPYNIE QLGDSDYRIS MAVAGFTQEE        60
     LELSFQENLL TVKGNKQADT ERNYLYQGIA ERGFERRFQL ADYVRVKGAD LKNGLLHIDL       120
     VREVPEAMKP RKIEING                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page