(data stored in ACNUC7421 zone)

EMBL: CP000462.PE8

CP000462.PE8         Location/Qualifiers
FT   CDS             8298..8735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0008"
FT                   /product="16 kDa heat shock protein A"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38558"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA7"
FT                   /protein_id="ABK38558.1"
FT                   /translation="MRNLDFSHLYSNAVGFERMARELEGLFEQKTAAYPPYNIEKRDQD
FT                   GYRITVAVAGFEREELELETENGTLKVKGRKAATDERQFLHQGIAERDFELAFKLSQHV
FT                   EVQGAKLEHGLLTIDLARELPEALKPRAIPIGKPEQLALPG"
     MRNLDFSHLY SNAVGFERMA RELEGLFEQK TAAYPPYNIE KRDQDGYRIT VAVAGFEREE        60
     LELETENGTL KVKGRKAATD ERQFLHQGIA ERDFELAFKL SQHVEVQGAK LEHGLLTIDL       120
     ARELPEALKP RAIPIGKPEQ LALPG                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page