(data stored in ACNUC7421 zone)

EMBL: CP000462.PE85

CP000462.PE85        Location/Qualifiers
FT   CDS             104281..105027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04445"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36028"
FT                   /db_xref="GOA:A0KEG6"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEG6"
FT                   /protein_id="ABK36028.1"
FT                   /translation="MQILLEDPAKAPQAEALASQLGQTDLPQFALVFTAARLELRKLDE
FT                   PKLGAVYVDFVEGAVAHRRKFGGGRGQSIAKAVGLKAGAMPRVVDATAGLGRDAFVLAS
FT                   LGCKVTMIERSPVVAALLQDGLARAALDPEIGPWVRERMQLRHGPAVETLLGLTERPDV
FT                   IYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADALLPAALAMADKRVVVKRPDYAGWL
FT                   NEHKPSMAIETKSNRFDVYVMAALAG"
     MQILLEDPAK APQAEALASQ LGQTDLPQFA LVFTAARLEL RKLDEPKLGA VYVDFVEGAV        60
     AHRRKFGGGR GQSIAKAVGL KAGAMPRVVD ATAGLGRDAF VLASLGCKVT MIERSPVVAA       120
     LLQDGLARAA LDPEIGPWVR ERMQLRHGPA VETLLGLTER PDVIYLDPMF PHKQKSALVK       180
     KEMRVFQSLV GPDLDADALL PAALAMADKR VVVKRPDYAG WLNEHKPSMA IETKSNRFDV       240
     YVMAALAG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page