(data stored in ACNUC7421 zone)

EMBL: CP000462.PE86

CP000462.PE86        Location/Qualifiers
FT   CDS             complement(105382..106371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36472"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEG7"
FT                   /protein_id="ABK36472.1"
FT                   /translation="MDAMKPLTLIGLTALLTACGGGGGGDNNSPQQAQLSLAFSDAPVD
FT                   AVSKVCIAVANISIHPVAGTEQSWTTASFLTSTQDDGCTPSGETIPLDSAGRPLFTYID
FT                   LLHYQGSVSRPLLASQSVEPGDYSQMRLRVLDGREVANQFLDGTPYSYVKRDDGVIKPL
FT                   EVPSSELKLDAFTIAANGLSAFTTEFDLRQAMVLPGHEQYYKLKPRGVRLVNNTQVTTV
FT                   KGTVAAGLCGGQLTDKAFVYFYQPRSDDNYPDMADSDNGFYASAPVLPQSGGGFGYELG
FT                   FVNLGSYDLALVCNGNEDDPALAGDPLQLEQVQQAQAVVAPATSINFQ"
     MDAMKPLTLI GLTALLTACG GGGGGDNNSP QQAQLSLAFS DAPVDAVSKV CIAVANISIH        60
     PVAGTEQSWT TASFLTSTQD DGCTPSGETI PLDSAGRPLF TYIDLLHYQG SVSRPLLASQ       120
     SVEPGDYSQM RLRVLDGREV ANQFLDGTPY SYVKRDDGVI KPLEVPSSEL KLDAFTIAAN       180
     GLSAFTTEFD LRQAMVLPGH EQYYKLKPRG VRLVNNTQVT TVKGTVAAGL CGGQLTDKAF       240
     VYFYQPRSDD NYPDMADSDN GFYASAPVLP QSGGGFGYEL GFVNLGSYDL ALVCNGNEDD       300
     PALAGDPLQL EQVQQAQAVV APATSINFQ                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page