(data stored in ACNUC7421 zone)

EMBL: CP000462.PE87

CP000462.PE87        Location/Qualifiers
FT   CDS             complement(106568..108058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0096"
FT                   /product="guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="identified by match to protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39541"
FT                   /db_xref="GOA:A0KEG8"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEG8"
FT                   /protein_id="ABK39541.1"
FT                   /translation="MHNSPLYAAIDLGSNSFHMLVVREVAGALRTVTKVKRKVRLAAGL
FT                   DPEFRLSRAAMERGWDCLRLFSEQLQDIPADNIRVVGTATLRLATNVDEFLSEAERVLN
FT                   HSIEIISGEEEAKTIYEGVSWTSAGEGNRLVIDIGGASTELVIGEHSEAKLLNSLHMGC
FT                   VTWLNNHFGDGELSEARFKQAIAAAKAVLEKVAEDYRALGWRTCVGASGTVQALQEIML
FT                   AQGKSERVTLPKLQELMGQAIACGKLDQLQLEGLAAERLTVFPSGLAILIAIFETLGIE
FT                   SMTLAGGALREGLIYGLLGNNHDCDARDRTADSLINRYQLDKEHAERVRDTAVEAFNQL
FT                   QPAWRLSKRYGRPILRYAALLHEIGLCIEYKKAPQHAAYIIDNIDMPGFTPAQKKLLSA
FT                   LLFNQRDEFKLEPLEKQGAVTGRQAIRLARILRIALILCMRRTQGTVPRFTLEADEDAL
FT                   TLTLPSGWLDEHYLRASELRFEVERQQKMGWPTRLLEA"
     MHNSPLYAAI DLGSNSFHML VVREVAGALR TVTKVKRKVR LAAGLDPEFR LSRAAMERGW        60
     DCLRLFSEQL QDIPADNIRV VGTATLRLAT NVDEFLSEAE RVLNHSIEII SGEEEAKTIY       120
     EGVSWTSAGE GNRLVIDIGG ASTELVIGEH SEAKLLNSLH MGCVTWLNNH FGDGELSEAR       180
     FKQAIAAAKA VLEKVAEDYR ALGWRTCVGA SGTVQALQEI MLAQGKSERV TLPKLQELMG       240
     QAIACGKLDQ LQLEGLAAER LTVFPSGLAI LIAIFETLGI ESMTLAGGAL REGLIYGLLG       300
     NNHDCDARDR TADSLINRYQ LDKEHAERVR DTAVEAFNQL QPAWRLSKRY GRPILRYAAL       360
     LHEIGLCIEY KKAPQHAAYI IDNIDMPGFT PAQKKLLSAL LFNQRDEFKL EPLEKQGAVT       420
     GRQAIRLARI LRIALILCMR RTQGTVPRFT LEADEDALTL TLPSGWLDEH YLRASELRFE       480
     VERQQKMGWP TRLLEA                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page