(data stored in ACNUC7421 zone)

EMBL: CP000462.PE88

CP000462.PE88        Location/Qualifiers
FT   CDS             complement(108073..109362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0097"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39109"
FT                   /db_xref="GOA:A0KEG9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEG9"
FT                   /protein_id="ABK39109.1"
FT                   /translation="MSKTHLTTDKFAQMGLEPEVLAGLESKGFHYCTPIQALSLPLLVE
FT                   GHDLAGQAQTGTGKTLAFLAATFNYLLTHPLTKPRLINQPRAIIMAPTRELAVQIYNDA
FT                   ESMSASTGLKLGLAYGGEGYDKQLAVLEQGVDILIGTTGRIIDYFKSKVIDLSNIQVVV
FT                   LDEADRMFDLGFIKDIRFLFRRMPPATERLSMLFSATLSLRVQELAYEHMNHPEHVQIE
FT                   PEQMTGVRIKEELFYPSNEDKMLLLLSLMEEEWPEKAIVFANTKHVCEDVHAWLENDGH
FT                   RVGLLTGDVPQKKRMKILEDFTKGTVDILVATDVAARGLHIPDVTHVFNYDLPDDAEDY
FT                   VHRIGRTGRAGKSGHSISLACEDYAFNLPAIEEYIHHPIPVSKYDREALLDDVTAPKRV
FT                   FRNRQPVNRNMRDRQGGGNSNNRRRPPRKS"
     MSKTHLTTDK FAQMGLEPEV LAGLESKGFH YCTPIQALSL PLLVEGHDLA GQAQTGTGKT        60
     LAFLAATFNY LLTHPLTKPR LINQPRAIIM APTRELAVQI YNDAESMSAS TGLKLGLAYG       120
     GEGYDKQLAV LEQGVDILIG TTGRIIDYFK SKVIDLSNIQ VVVLDEADRM FDLGFIKDIR       180
     FLFRRMPPAT ERLSMLFSAT LSLRVQELAY EHMNHPEHVQ IEPEQMTGVR IKEELFYPSN       240
     EDKMLLLLSL MEEEWPEKAI VFANTKHVCE DVHAWLENDG HRVGLLTGDV PQKKRMKILE       300
     DFTKGTVDIL VATDVAARGL HIPDVTHVFN YDLPDDAEDY VHRIGRTGRA GKSGHSISLA       360
     CEDYAFNLPA IEEYIHHPIP VSKYDREALL DDVTAPKRVF RNRQPVNRNM RDRQGGGNSN       420
     NRRRPPRKS                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page