(data stored in ACNUC7421 zone)

EMBL: CP000462.PE9

CP000462.PE9         Location/Qualifiers
FT   CDS             complement(8809..10059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0009"
FT                   /product="valine--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.66"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38117"
FT                   /db_xref="GOA:A0KEA8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEA8"
FT                   /protein_id="ABK38117.1"
FT                   /translation="MEFSLFGEKFTRHAGITQLMDDLNQGLTNPDAIMLGGGNPAPIPA
FT                   MLERFQAEAKSLLDNGELVKAMANYDGPQGKDRFTKALAALLSKELGWDISARNIALTN
FT                   GSQNAFFYLFNLLAGEFADGRKKKVLFPLAPEYIGYADSALADDYFVAYKPTIEKLADG
FT                   QFKYHVDFESLQVGDDIGVICVSRPTNPTGNVLTDEEIEHLDQIARDKGIPLLIDNAYG
FT                   VPFPGIIFSEAKPFWNANTILCMSLSKLGLPGTRCGIVIADEKIIQAITNLSGIINLAP
FT                   GSLGPAITIPMIESGEIIALSEQVVKPFYRQKAELAVQLLREAIPDPRFHIHKPEGALF
FT                   LWLWFEGLPIHCQELYERLKAKNLLIVPGHYFFPGIDDPEWRHSQECIRLNYSQSEELV
FT                   RRGIAILADEINALYAG"
     MEFSLFGEKF TRHAGITQLM DDLNQGLTNP DAIMLGGGNP APIPAMLERF QAEAKSLLDN        60
     GELVKAMANY DGPQGKDRFT KALAALLSKE LGWDISARNI ALTNGSQNAF FYLFNLLAGE       120
     FADGRKKKVL FPLAPEYIGY ADSALADDYF VAYKPTIEKL ADGQFKYHVD FESLQVGDDI       180
     GVICVSRPTN PTGNVLTDEE IEHLDQIARD KGIPLLIDNA YGVPFPGIIF SEAKPFWNAN       240
     TILCMSLSKL GLPGTRCGIV IADEKIIQAI TNLSGIINLA PGSLGPAITI PMIESGEIIA       300
     LSEQVVKPFY RQKAELAVQL LREAIPDPRF HIHKPEGALF LWLWFEGLPI HCQELYERLK       360
     AKNLLIVPGH YFFPGIDDPE WRHSQECIRL NYSQSEELVR RGIAILADEI NALYAG           416
//

If you have problems or comments...

PBIL Back to PBIL home page