(data stored in ACNUC7421 zone)

EMBL: CP000462.PE93

CP000462.PE93        Location/Qualifiers
FT   CDS             114058..114756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0102"
FT                   /product="NAD(P)H-flavin reductase (FMN reductase)"
FT                   /EC_number="1.16.1.3"
FT                   /note="Aquacobalamin reductase; NAD(P)H:flavin
FT                   oxidoreductase; identified by match to protein family HMM
FT                   PF00175; match to protein family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37410"
FT                   /db_xref="GOA:A0KEH4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH4"
FT                   /protein_id="ABK37410.1"
FT                   /translation="MQRIKCRVEELREYVDTIWHVALTPLQEVSFKPGQYLLVVMSDSD
FT                   KRPFSIANSPTRPGMLELQIGATPENAYAGQVLARMREQGEIEIELAAGKAFLREESPR
FT                   PLILMAGGTGFSYARSILEYLIDTGSKRPVFFYWGVRQAHWLYEQEQMQQWERDYAPLT
FT                   FIPVVQEPEVDWTGKTGLVHKAIMDDFVSLHDYDIYVAGRFEMAGAAREEFKILGAEPE
FT                   RIFGDAYEFI"
     MQRIKCRVEE LREYVDTIWH VALTPLQEVS FKPGQYLLVV MSDSDKRPFS IANSPTRPGM        60
     LELQIGATPE NAYAGQVLAR MREQGEIEIE LAAGKAFLRE ESPRPLILMA GGTGFSYARS       120
     ILEYLIDTGS KRPVFFYWGV RQAHWLYEQE QMQQWERDYA PLTFIPVVQE PEVDWTGKTG       180
     LVHKAIMDDF VSLHDYDIYV AGRFEMAGAA REEFKILGAE PERIFGDAYE FI               232
//

If you have problems or comments...

PBIL Back to PBIL home page