(data stored in ACNUC7421 zone)

EMBL: CP000462.PE94

CP000462.PE94        Location/Qualifiers
FT   CDS             complement(114886..115143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04380"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37642"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH5"
FT                   /protein_id="ABK37642.1"
FT                   /translation="MIDPKKLEEIAKQVHNSLPPGIRSMGEEVEKKIRQVLQSQLGKLD
FT                   LVSREEFDVQTKVLLRTREKLTALEAKLAQLEQQLGAKGE"
     MIDPKKLEEI AKQVHNSLPP GIRSMGEEVE KKIRQVLQSQ LGKLDLVSRE EFDVQTKVLL        60
     RTREKLTALE AKLAQLEQQL GAKGE                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page