(data stored in ACNUC7421 zone)

EMBL: CP000462.PE98

CP000462.PE98        Location/Qualifiers
FT   CDS             119226..119912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0108"
FT                   /product="efflux protein, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37718"
FT                   /db_xref="GOA:A0KEH9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH9"
FT                   /protein_id="ABK37718.1"
FT                   /translation="MSGYCRDRSQFPSIPGAGCRLGWGLLLLLRALFMETSLLLSMAGF
FT                   ALAMSITPGPVNLVALGSGARHGFAASLRHVVGATLGFILLLLLMGLGLGATLLQWPLA
FT                   AELLRWAGVIFLGWMAWQLLVDSGRVEGVDGVAPSFWYGALMQWLNPKAWLAASMGMGA
FT                   YGSAGGVGQVALFSGLYLVICLGSIACWAYAGSRLQGVLLAPQRLRWFNRAMALLLLLC
FT                   AAYLVR"
     MSGYCRDRSQ FPSIPGAGCR LGWGLLLLLR ALFMETSLLL SMAGFALAMS ITPGPVNLVA        60
     LGSGARHGFA ASLRHVVGAT LGFILLLLLM GLGLGATLLQ WPLAAELLRW AGVIFLGWMA       120
     WQLLVDSGRV EGVDGVAPSF WYGALMQWLN PKAWLAASMG MGAYGSAGGV GQVALFSGLY       180
     LVICLGSIAC WAYAGSRLQG VLLAPQRLRW FNRAMALLLL LCAAYLVR                    228
//

If you have problems or comments...

PBIL Back to PBIL home page