(data stored in ACNUC7421 zone)

EMBL: CP000462.PLSB

CP000462.PLSB        Location/Qualifiers
FT   CDS             complement(197570..199993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="AHA_0182"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36673"
FT                   /db_xref="GOA:A0KEQ0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEQ0"
FT                   /protein_id="ABK36673.1"
FT                   /translation="MSLGQNISRAILQWPVSGLVNHKSLPENPITELKLDPARPIVYAL
FT                   KTSSITDLMTLQQCCEDLGLPGPFTPLELNGQLLPRYVCLDRPPPLFGKRSKPLPFLQE
FT                   FHQLLDLHKQDPALDIQVVPVTLFWGRAPGREGEEASGWNIISSLAPNRLKKALIVILK
FT                   GRENLVRFSPPLSLRHMADKHGTDEAIAHKLARVARTHFSRQQLAATGPKLPNRNLLFK
FT                   QLLDSNVIQQAIEEEAQREGISLEKAQKRAHGYMDEIASDFSYRLIRLGESFLGWLWNK
FT                   LYRGLSVNGAEKVRQLAQEGHEIVYVPCHRSHMDYLLLSYVIYHQGMVPPHIAAGINLN
FT                   FWPAGPIFRHGGAFFIRRTFKGNPLYSTVFREYLNLLFAKGYSVEFFTEGGRSRTGRLL
FT                   PPKTGMLAMTLQAMMRGLDRPVTLVPVYLGYEHVMEVNTYHNELKGSRKEKESFLQVLG
FT                   ILRKLRNYGRGFVNFGEPLTLNNYLNEHVPSWKEHIGEEERPEWMAPTVNQLAELLMTR
FT                   INGAAAVNGLTLSALALLAAERHALTRDELQAQLNTYLDLLKQVPYSPHSTIPDEDAKT
FT                   LLDQAMELNKFEVSEDKLGQIVSLDRYQAILLTYYRNNILHLFAMPSLVAALIERCEGI
FT                   SRSEIVARCIDIYPLLKTELFLRYEEDELPELVDALLAELQRQQLIEARDGGFWVNPVN
FT                   QTRLLLLAESIQETLQRYAIVLTRVLAQPRIEAEQLEADGLMMAERLGTLHGINAPEFF
FT                   DQKLFSTLIHTLRSEGYLDPGCKPDLGRFQALADNIVPLLSTKIRRTIQAGNRL"
     MSLGQNISRA ILQWPVSGLV NHKSLPENPI TELKLDPARP IVYALKTSSI TDLMTLQQCC        60
     EDLGLPGPFT PLELNGQLLP RYVCLDRPPP LFGKRSKPLP FLQEFHQLLD LHKQDPALDI       120
     QVVPVTLFWG RAPGREGEEA SGWNIISSLA PNRLKKALIV ILKGRENLVR FSPPLSLRHM       180
     ADKHGTDEAI AHKLARVART HFSRQQLAAT GPKLPNRNLL FKQLLDSNVI QQAIEEEAQR       240
     EGISLEKAQK RAHGYMDEIA SDFSYRLIRL GESFLGWLWN KLYRGLSVNG AEKVRQLAQE       300
     GHEIVYVPCH RSHMDYLLLS YVIYHQGMVP PHIAAGINLN FWPAGPIFRH GGAFFIRRTF       360
     KGNPLYSTVF REYLNLLFAK GYSVEFFTEG GRSRTGRLLP PKTGMLAMTL QAMMRGLDRP       420
     VTLVPVYLGY EHVMEVNTYH NELKGSRKEK ESFLQVLGIL RKLRNYGRGF VNFGEPLTLN       480
     NYLNEHVPSW KEHIGEEERP EWMAPTVNQL AELLMTRING AAAVNGLTLS ALALLAAERH       540
     ALTRDELQAQ LNTYLDLLKQ VPYSPHSTIP DEDAKTLLDQ AMELNKFEVS EDKLGQIVSL       600
     DRYQAILLTY YRNNILHLFA MPSLVAALIE RCEGISRSEI VARCIDIYPL LKTELFLRYE       660
     EDELPELVDA LLAELQRQQL IEARDGGFWV NPVNQTRLLL LAESIQETLQ RYAIVLTRVL       720
     AQPRIEAEQL EADGLMMAER LGTLHGINAP EFFDQKLFST LIHTLRSEGY LDPGCKPDLG       780
     RFQALADNIV PLLSTKIRRT IQAGNRL                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page