(data stored in ACNUC7421 zone)

EMBL: CP000462.PPC

CP000462.PPC         Location/Qualifiers
FT   CDS             complement(626974..629607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="AHA_0591"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="identified by match to protein family HMM PF00311"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39687"
FT                   /db_xref="GOA:A0KFU8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFU8"
FT                   /protein_id="ABK39687.1"
FT                   /translation="MNEKYAALRANVGMLGQLLGKSIKDHQGQAFLDKIETIRQLAKSS
FT                   RKGNETDRERLLDTLRNLSDDELLPVARAFSQFLNLANVAEQFHTISRRCEEQVCTPDP
FT                   LEQMFDKLKASNLSQEAIIQAVRELDIDLVLTAHPTEVTRRTLIHKHVQLNDCLEALEL
FT                   SDLLPRERDKILNRIEQLVNQAWHTNEIREQRPTPVDEAKWGFAVVENSLWPAIPEFMR
FT                   NLDERLQHHLGVRLPLDAAPVKFTSWMGGDRDGNPFVTAKVTAEVLELGRWMAVSLFYK
FT                   DIKELTSELSMSDCTDAVRERVGDHPEPYRALVRELREQLRETQEFLTAKVQGQASESR
FT                   DLVKTTAQLREPLELCYHSLHACGMGNIADGMLLDVLRKLACFGIHLVKLDIRQDGERH
FT                   GQVFSELTRYLGMGDYAEWSEDDKQAFLLNELNSRRPLIPTDWEPSDETRETLDTCKVI
FT                   AQHDPDAFGIYIISMAGAPSDVLAVQLLLKEAGCKFRMPVAPLFETQEDLMAGTAVMER
FT                   LLSVDWYRGYIQGRQYVMIGYSDSAKDAGMMAAGWAQYAAMESLVALAEANNLRLTLFH
FT                   GRGGTVGRGGAPAHQAILSQPPGSLRGGLRVTEQGEMIRFKFGLPKVAIQSLNLYTSAV
FT                   LEGNLLPPPKPKECWRAVMEQLASVSCDHYRSIVRGHPDFVPYFRAATPEMELGKLPLG
FT                   SRPSKRKPNGGVESLRAIPWIFAWTQNRLMLPAWLGAHKGLQQAIADGQKGVLEEMSRQ
FT                   WPFFRTRLEMLEMVFLKADVWLAEYYDTRLVPKELWGLGKQLRQELADSIQVVLELRPQ
FT                   GDLLDDQPWIKESIKLRNPYTDPLNVLQVELLGRSRNHAETLHPELDQALMVTIAGIAA
FT                   GMRNTG"
     MNEKYAALRA NVGMLGQLLG KSIKDHQGQA FLDKIETIRQ LAKSSRKGNE TDRERLLDTL        60
     RNLSDDELLP VARAFSQFLN LANVAEQFHT ISRRCEEQVC TPDPLEQMFD KLKASNLSQE       120
     AIIQAVRELD IDLVLTAHPT EVTRRTLIHK HVQLNDCLEA LELSDLLPRE RDKILNRIEQ       180
     LVNQAWHTNE IREQRPTPVD EAKWGFAVVE NSLWPAIPEF MRNLDERLQH HLGVRLPLDA       240
     APVKFTSWMG GDRDGNPFVT AKVTAEVLEL GRWMAVSLFY KDIKELTSEL SMSDCTDAVR       300
     ERVGDHPEPY RALVRELREQ LRETQEFLTA KVQGQASESR DLVKTTAQLR EPLELCYHSL       360
     HACGMGNIAD GMLLDVLRKL ACFGIHLVKL DIRQDGERHG QVFSELTRYL GMGDYAEWSE       420
     DDKQAFLLNE LNSRRPLIPT DWEPSDETRE TLDTCKVIAQ HDPDAFGIYI ISMAGAPSDV       480
     LAVQLLLKEA GCKFRMPVAP LFETQEDLMA GTAVMERLLS VDWYRGYIQG RQYVMIGYSD       540
     SAKDAGMMAA GWAQYAAMES LVALAEANNL RLTLFHGRGG TVGRGGAPAH QAILSQPPGS       600
     LRGGLRVTEQ GEMIRFKFGL PKVAIQSLNL YTSAVLEGNL LPPPKPKECW RAVMEQLASV       660
     SCDHYRSIVR GHPDFVPYFR AATPEMELGK LPLGSRPSKR KPNGGVESLR AIPWIFAWTQ       720
     NRLMLPAWLG AHKGLQQAIA DGQKGVLEEM SRQWPFFRTR LEMLEMVFLK ADVWLAEYYD       780
     TRLVPKELWG LGKQLRQELA DSIQVVLELR PQGDLLDDQP WIKESIKLRN PYTDPLNVLQ       840
     VELLGRSRNH AETLHPELDQ ALMVTIAGIA AGMRNTG                                877
//

If you have problems or comments...

PBIL Back to PBIL home page