(data stored in ACNUC7421 zone)

EMBL: CP000462.PURE-1

CP000462.PURE-1      Location/Qualifiers
FT   CDS             complement(78228..78737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE-1"
FT                   /locus_tag="AHA_0070"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37859"
FT                   /db_xref="GOA:A0KEE2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE2"
FT                   /protein_id="ABK37859.1"
FT                   /translation="MNTPPLIGLVMGSDSDWPVMQAAARILKEHGVPYEARVVSAHRTP
FT                   DLLFEYAASARERGLRAIIAGAGGAAHLPGMVAAKTTIPVLGVPIPTRQLKGMDSLLSI
FT                   VQMPKGVPVATFAIGEAGAANAGLFAVSLLSVAQDGDAPRYQQQLDGFRANERDRVLAL
FT                   TLEDPA"
     MNTPPLIGLV MGSDSDWPVM QAAARILKEH GVPYEARVVS AHRTPDLLFE YAASARERGL        60
     RAIIAGAGGA AHLPGMVAAK TTIPVLGVPI PTRQLKGMDS LLSIVQMPKG VPVATFAIGE       120
     AGAANAGLFA VSLLSVAQDG DAPRYQQQLD GFRANERDRV LALTLEDPA                   169
//

If you have problems or comments...

PBIL Back to PBIL home page