(data stored in ACNUC7421 zone)

EMBL: CP000462.PURK

CP000462.PURK        Location/Qualifiers
FT   CDS             complement(77107..78231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="AHA_0069"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37904"
FT                   /db_xref="GOA:A0KEE1"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE1"
FT                   /protein_id="ABK37904.1"
FT                   /translation="MILPPATLGMLGGGQLGRYFVMAAHRLGYKVVVLDPDPASIAGAA
FT                   ADHHIVAAYDDPTALHDLASRCAAVTCEFENVPATALALLEQYQPVRPAAGAVRICQDR
FT                   REEKAFLSRAGIPVAPNQTLLPGEPLPALPASLFPAILKTAREGYDGKGQWTIQAADQL
FT                   PAALAASGVPCVLEQRLALEGEFSLTLARSPSGAIGALPLVQNWHSGGILDQTRSPANV
FT                   PALEADARRIAEQLIAALDYVGVLTVELFLVAGKLLVNELAPRPHNSGHPSLDNAECSQ
FT                   FELQVRALCDLPLPSRIAVRPAMLLNLLGDLWQAGTPDWAALLALPGVHLHLYGKGEPR
FT                   PGRKMGHVTITAADWPTVEETCQRVRQLLGLPPR"
     MILPPATLGM LGGGQLGRYF VMAAHRLGYK VVVLDPDPAS IAGAAADHHI VAAYDDPTAL        60
     HDLASRCAAV TCEFENVPAT ALALLEQYQP VRPAAGAVRI CQDRREEKAF LSRAGIPVAP       120
     NQTLLPGEPL PALPASLFPA ILKTAREGYD GKGQWTIQAA DQLPAALAAS GVPCVLEQRL       180
     ALEGEFSLTL ARSPSGAIGA LPLVQNWHSG GILDQTRSPA NVPALEADAR RIAEQLIAAL       240
     DYVGVLTVEL FLVAGKLLVN ELAPRPHNSG HPSLDNAECS QFELQVRALC DLPLPSRIAV       300
     RPAMLLNLLG DLWQAGTPDW AALLALPGVH LHLYGKGEPR PGRKMGHVTI TAADWPTVEE       360
     TCQRVRQLLG LPPR                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page