(data stored in ACNUC7421 zone)

EMBL: CP000462.RECF

CP000462.RECF        Location/Qualifiers
FT   CDS             2783..3886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="AHA_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37230"
FT                   /db_xref="GOA:A0KEE8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE8"
FT                   /protein_id="ABK37230.1"
FT                   /translation="MSLVKLQLSDFRNIQQASLALSPGLNILVGCNGSGKTSVLEAIHY
FT                   LGLGRSFRTHLTGRVIRQGERAFTLFAQCELEGRQVPIGLAKDKSGETQLKIAGAQAQR
FT                   LAELAELLPVQLIHPDGFNLLTGGPQARRAWLDWGVFHQEPTFFSLWGRVRRLLKQRNA
FT                   LLRQSSQYRQLAYWDQELVRLGGELAEFRASYCQAITPLIKEMTADFLPEFDISLGFYR
FT                   GWEKDTPLNALLEAGFERDRALGYTGVGPQKADVRLKANGVPAQDILSRGQLKLLVCAM
FT                   RLAQGLYLNQHSSRGCIFLIDDFASELDVDKRRLLAARLKQCASQVFITAIDTGQLADM
FT                   MDANDCKLFHVEQGKISETLEKAESKL"
     MSLVKLQLSD FRNIQQASLA LSPGLNILVG CNGSGKTSVL EAIHYLGLGR SFRTHLTGRV        60
     IRQGERAFTL FAQCELEGRQ VPIGLAKDKS GETQLKIAGA QAQRLAELAE LLPVQLIHPD       120
     GFNLLTGGPQ ARRAWLDWGV FHQEPTFFSL WGRVRRLLKQ RNALLRQSSQ YRQLAYWDQE       180
     LVRLGGELAE FRASYCQAIT PLIKEMTADF LPEFDISLGF YRGWEKDTPL NALLEAGFER       240
     DRALGYTGVG PQKADVRLKA NGVPAQDILS RGQLKLLVCA MRLAQGLYLN QHSSRGCIFL       300
     IDDFASELDV DKRRLLAARL KQCASQVFIT AIDTGQLADM MDANDCKLFH VEQGKISETL       360
     EKAESKL                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page