(data stored in ACNUC7421 zone)

EMBL: CP000462.RHO

CP000462.RHO         Location/Qualifiers
FT   CDS             110010..111275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="AHA_0099"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM PF08206;
FT                   match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39781"
FT                   /db_xref="GOA:A0KEH1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEH1"
FT                   /protein_id="ABK39781.1"
FT                   /translation="MNLTELKNTPVSELVQLGESMGLENLARAHKKDIIFAILKAHAKG
FT                   GEDIFGDGVLEILTDGFGFLRSADGSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDRPENSRNKILFENLTPLHANERLRMERGNGSTEDITARVLD
FT                   LASPIGKGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCELIVLLIDERPEEVTEMQRM
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVYPAIDITRSGTRKEELLTTGDELQKMWILRKIVHPMGEIDGIEFL
FT                   IDKLAMTKTNDEFFDAMRRQQK"
     MNLTELKNTP VSELVQLGES MGLENLARAH KKDIIFAILK AHAKGGEDIF GDGVLEILTD        60
     GFGFLRSADG SYLAGPDDIY VSPSQIRRFN LRTGDTISGK IRPPKEGERY FALLKVNEVN       120
     YDRPENSRNK ILFENLTPLH ANERLRMERG NGSTEDITAR VLDLASPIGK GQRGLIVAPP       180
     KAGKTMLLQN IAQSIAYNHP DCELIVLLID ERPEEVTEMQ RMVKGEVIAS TFDEPASRHV       240
     QVAEMVIEKA KRLVEHKKDV VILLDSITRL ARAYNTVIPS SGKVLTGGVD ANALHRPKRF       300
     FGAARNVEEG GSLTIIATAL IDTGSKMDEV IYEEFKGTGN MELHLSRKIA EKRVYPAIDI       360
     TRSGTRKEEL LTTGDELQKM WILRKIVHPM GEIDGIEFLI DKLAMTKTND EFFDAMRRQQ       420
     K                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page