(data stored in ACNUC7421 zone)

EMBL: CP000462.RNB

CP000462.RNB         Location/Qualifiers
FT   CDS             complement(587343..589364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnb"
FT                   /locus_tag="AHA_0554"
FT                   /product="exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /note="identified by match to protein family HMM PF00773;
FT                   match to protein family HMM PF08206; match to protein
FT                   family HMM TIGR00358; match to protein family HMM
FT                   TIGR02062"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38105"
FT                   /db_xref="GOA:A0KFR1"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011804"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFR1"
FT                   /protein_id="ABK38105.1"
FT                   /translation="MFQDNPLLAQLKQQIRENIPKKEGVIRASDRGFGFLEVDEKTSYF
FT                   VPPPYMKKVMHGDRVSALIRTEKEKEVAEPDALLEQSVTRFVARVKMFRDRLNVVADHP
FT                   LIKDAIKARVKKGLDEKEFKEGDWVVATLKRHALVDGNFSAEITQTIASQEDHNVPWWV
FT                   VLARHNLAQVEPADLPEWKVIEEEELPRTDLTATPFFTIDGAKTKDMDDALAIRKLDNG
FT                   WELLVAIADPTAYVAEGSELDKEAAQRAFTVYMPGRNVPMIPRTLSDELCSLKEGEERN
FT                   TLCARLLIAEDGLLLEETEFFAARISSHARLTYDDVSDWAEHGKQLDIDAGVLAQLPLM
FT                   KAMTEARIAWRTEHALVFPDRPDYDFELGENGEVLAIHVEPRRIANRMVEESMIAANIC
FT                   AGRVLGKQVGYGIFNVHTGFDEESLDGAIDLLKSAEAPFEKEEIASLSGFCALRRWIDN
FT                   LDTRWLDGKIRRFQSYALMSAEPGAHYGLGLDAYATWTSPIRKYGDMVNHRLLKAVIAG
FT                   KTPGERPSLELTEHLTACRRLHRMVERDIGDWLYVRYLKADAGTDKVFNAEIIDVMRAG
FT                   LKLRLRENGAVVFMPARHILDNKDRLECNWDNGRVYLDKTEVVYELGQIIEVKLTEAVE
FT                   ETRSLIAKPAVELVPGPAPVAPTSEADATPADEAPKAE"
     MFQDNPLLAQ LKQQIRENIP KKEGVIRASD RGFGFLEVDE KTSYFVPPPY MKKVMHGDRV        60
     SALIRTEKEK EVAEPDALLE QSVTRFVARV KMFRDRLNVV ADHPLIKDAI KARVKKGLDE       120
     KEFKEGDWVV ATLKRHALVD GNFSAEITQT IASQEDHNVP WWVVLARHNL AQVEPADLPE       180
     WKVIEEEELP RTDLTATPFF TIDGAKTKDM DDALAIRKLD NGWELLVAIA DPTAYVAEGS       240
     ELDKEAAQRA FTVYMPGRNV PMIPRTLSDE LCSLKEGEER NTLCARLLIA EDGLLLEETE       300
     FFAARISSHA RLTYDDVSDW AEHGKQLDID AGVLAQLPLM KAMTEARIAW RTEHALVFPD       360
     RPDYDFELGE NGEVLAIHVE PRRIANRMVE ESMIAANICA GRVLGKQVGY GIFNVHTGFD       420
     EESLDGAIDL LKSAEAPFEK EEIASLSGFC ALRRWIDNLD TRWLDGKIRR FQSYALMSAE       480
     PGAHYGLGLD AYATWTSPIR KYGDMVNHRL LKAVIAGKTP GERPSLELTE HLTACRRLHR       540
     MVERDIGDWL YVRYLKADAG TDKVFNAEII DVMRAGLKLR LRENGAVVFM PARHILDNKD       600
     RLECNWDNGR VYLDKTEVVY ELGQIIEVKL TEAVEETRSL IAKPAVELVP GPAPVAPTSE       660
     ADATPADEAP KAE                                                          673
//

If you have problems or comments...

PBIL Back to PBIL home page