(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLC

CP000462.RPLC        Location/Qualifiers
FT   CDS             335801..336433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="AHA_0309"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37830"
FT                   /db_xref="GOA:A0KF21"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF21"
FT                   /protein_id="ABK37830.1"
FT                   /translation="MTIGLVGRKVGMTRIFTEDGVSIPVTVIEVEANRVTQVKSVETDG
FT                   YNAIQVTTGAKKASRVTKPEAGHFAKAGVEAGRGLWEFRLNNGETFTVGSELKVDLLAD
FT                   VKLVDVTGTSKGKGFAGTVKRWNFRTQDMTHGNSLSHRVPGSIGQNQTPGRVFKGKKMA
FT                   GHMGAERVTTQNLELVRVDAERNLLLIKGAVPGATNGNVIVKPAVKA"
     MTIGLVGRKV GMTRIFTEDG VSIPVTVIEV EANRVTQVKS VETDGYNAIQ VTTGAKKASR        60
     VTKPEAGHFA KAGVEAGRGL WEFRLNNGET FTVGSELKVD LLADVKLVDV TGTSKGKGFA       120
     GTVKRWNFRT QDMTHGNSLS HRVPGSIGQN QTPGRVFKGK KMAGHMGAER VTTQNLELVR       180
     VDAERNLLLI KGAVPGATNG NVIVKPAVKA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page