(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLD

CP000462.RPLD        Location/Qualifiers
FT   CDS             336451..337056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="AHA_0310"
FT                   /product="ribosomal protein L4/L1 family"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37119"
FT                   /db_xref="GOA:A0KF22"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF22"
FT                   /protein_id="ABK37119.1"
FT                   /translation="MELVMKDAKSALEVSETTFGREFNEALVHQVVVAYAAGARQGTRA
FT                   QLTRSEVSGGGKKPWRQKGTGRARAGSIRSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   IRSILSELVRQERLIVVEKFGIEAPKTKELIAKLKEMELTDVLIVTAEVDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVLMTADAVKQIEEMLA"
     MELVMKDAKS ALEVSETTFG REFNEALVHQ VVVAYAAGAR QGTRAQLTRS EVSGGGKKPW        60
     RQKGTGRARA GSIRSPIWRS GGVTFAAKPQ DHSQKVNKKM YRGAIRSILS ELVRQERLIV       120
     VEKFGIEAPK TKELIAKLKE MELTDVLIVT AEVDENLFLA ARNLYKVDVR DVAGIDPVSL       180
     IAFDKVLMTA DAVKQIEEML A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page