(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLN

CP000462.RPLN        Location/Qualifiers
FT   CDS             340579..340947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="AHA_0319"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38629"
FT                   /db_xref="GOA:A0KF31"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF31"
FT                   /protein_id="ABK38629.1"
FT                   /translation="MIQMQSMLGVADNSGARSVMCIKVLGGSHRRYAGIGDIIKVSIKE
FT                   AIPRGKVKKGDVYNAVVVRTRKGVRRPDGSVIRFDNNAAVLLNNNQQPIGTRIFGPVTR
FT                   ELRNEKFMKIVSLAPEVL"
     MIQMQSMLGV ADNSGARSVM CIKVLGGSHR RYAGIGDIIK VSIKEAIPRG KVKKGDVYNA        60
     VVVRTRKGVR RPDGSVIRFD NNAAVLLNNN QQPIGTRIFG PVTRELRNEK FMKIVSLAPE       120
     VL                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page