(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLO

CP000462.RPLO        Location/Qualifiers
FT   CDS             344173..344610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="AHA_0328"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35971"
FT                   /db_xref="GOA:A0KF40"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF40"
FT                   /protein_id="ABK35971.1"
FT                   /translation="MRLNTLSPAAGSKRVKHRPGRGIGSGLGKTGGRGVKGQTSRSGGG
FT                   KVRNGFEGGQMPLKIRLPKFGFFSRKSLVSAEVRLNEIALVEGDVVDVSTLKQAGVITK
FT                   NIVFAKVVLSGNIDRAVTVRGLSVTKGARAAIEAAGGKIEE"
     MRLNTLSPAA GSKRVKHRPG RGIGSGLGKT GGRGVKGQTS RSGGGKVRNG FEGGQMPLKI        60
     RLPKFGFFSR KSLVSAEVRL NEIALVEGDV VDVSTLKQAG VITKNIVFAK VVLSGNIDRA       120
     VTVRGLSVTK GARAAIEAAG GKIEE                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page