(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLP

CP000462.RPLP        Location/Qualifiers
FT   CDS             339579..339992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="AHA_0316"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37882"
FT                   /db_xref="GOA:A0KF28"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF28"
FT                   /protein_id="ABK37882.1"
FT                   /translation="MLQPKRTKFRKTHKGRNRGLANSGNEVSFGTFGLKATSRGQLTAR
FT                   QIEAARRAMTRHVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVCPIQPGKVLY
FT                   EMDGVPEALAREAFALAAAKLSVQTTFVIKTVM"
     MLQPKRTKFR KTHKGRNRGL ANSGNEVSFG TFGLKATSRG QLTARQIEAA RRAMTRHVKR        60
     QGKIWIRVFP DKPITEKPLE VRMGKGKGNV EYWVCPIQPG KVLYEMDGVP EALAREAFAL       120
     AAAKLSVQTT FVIKTVM                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page