(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLQ

CP000462.RPLQ        Location/Qualifiers
FT   CDS             348707..349090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="AHA_0334"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35840"
FT                   /db_xref="GOA:A0KF46"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF46"
FT                   /protein_id="ABK35840.1"
FT                   /translation="MRHRLSGRQLNRNSSHRQAMFRNMASSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDNAIVAKLFNELGPRYLERAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRPAAAEAAAE"
     MRHRLSGRQL NRNSSHRQAM FRNMASSLVR HEIIKTTLPK AKELRRVVEP LITLAKTDSV        60
     ANRRLAFART RDNAIVAKLF NELGPRYLER AGGYTRILKC GFRAGDNAPM AYIELVDRPA       120
     AAEAAAE                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page