(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLR

CP000462.RPLR        Location/Qualifiers
FT   CDS             343116..343469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="AHA_0325"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39842"
FT                   /db_xref="GOA:A0KF37"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF37"
FT                   /protein_id="ABK39842.1"
FT                   /translation="MDKKAARLRRATRARKKMQELGATRLVVHRTPRHIYAQVIAANGS
FT                   EVLASASTVEKAISEAIKYTGNADAATAVGKAIAERAIAKGVQNVSFDRSGFKYHGRIA
FT                   ALAAAARDAGLQF"
     MDKKAARLRR ATRARKKMQE LGATRLVVHR TPRHIYAQVI AANGSEVLAS ASTVEKAISE        60
     AIKYTGNADA ATAVGKAIAE RAIAKGVQNV SFDRSGFKYH GRIAALAAAA RDAGLQF          117
//

If you have problems or comments...

PBIL Back to PBIL home page