(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLV

CP000462.RPLV        Location/Qualifiers
FT   CDS             338504..338848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="AHA_0314"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38894"
FT                   /db_xref="GOA:A0KF26"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF26"
FT                   /protein_id="ABK38894.1"
FT                   /translation="MEAIAKHRYARTSAQKARLVADQVRGLSVDKALNILTFSPKKAAA
FT                   LVKKVLESAIANAEHNEGADIDALRVATIMVDEGPSMKRIRPRAKGRADRILKRTAHIT
FT                   VVVSDAKAGR"
     MEAIAKHRYA RTSAQKARLV ADQVRGLSVD KALNILTFSP KKAAALVKKV LESAIANAEH        60
     NEGADIDALR VATIMVDEGP SMKRIRPRAK GRADRILKRT AHITVVVSDA KAGR             114
//

If you have problems or comments...

PBIL Back to PBIL home page