(data stored in ACNUC7421 zone)

EMBL: CP000462.RPLX

CP000462.RPLX        Location/Qualifiers
FT   CDS             340959..341276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="AHA_0320"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37026"
FT                   /db_xref="GOA:A0KF32"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF32"
FT                   /protein_id="ABK37026.1"
FT                   /translation="MAAKIRREDEVIVLTGKDKGKRGKVTQVLIAKGKVIVEGINQVKK
FT                   HQKPVPALGQAGGIVTKEAPIDVSNVALFNSATGKADRVGFRIEDGKKVRFFKSTGELV
FT                   K"
     MAAKIRREDE VIVLTGKDKG KRGKVTQVLI AKGKVIVEGI NQVKKHQKPV PALGQAGGIV        60
     TKEAPIDVSN VALFNSATGK ADRVGFRIED GKKVRFFKST GELVK                       105
//

If you have problems or comments...

PBIL Back to PBIL home page