(data stored in ACNUC7421 zone)

EMBL: CP000462.RPOZ

CP000462.RPOZ        Location/Qualifiers
FT   CDS             complement(44384..44659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="AHA_0040"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01192;
FT                   match to protein family HMM TIGR00690"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37121"
FT                   /db_xref="GOA:A0KR23"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KR23"
FT                   /protein_id="ABK37121.1"
FT                   /translation="MARVTVEDAVKQVGNRFDLVLVAARRARQIAVQGKDPLVDEENDK
FT                   PTVIALREIELGLVNNQVMDTQDRYEQQEQEAAELAAVAAIAEGRG"
     MARVTVEDAV KQVGNRFDLV LVAARRARQI AVQGKDPLVD EENDKPTVIA LREIELGLVN        60
     NQVMDTQDRY EQQEQEAAEL AAVAAIAEGR G                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page