(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSD

CP000462.RPSD        Location/Qualifiers
FT   CDS             347028..347648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="AHA_0332"
FT                   /product="ribosomal protein S4"
FT                   /note="identified by match to protein family HMM PF00163;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR01017"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36993"
FT                   /db_xref="GOA:A0KF44"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF44"
FT                   /protein_id="ABK36993.1"
FT                   /translation="MARYIGPKLKLSRREGTDLFLKSGVRAIDSKCKIDTVPGQHGARK
FT                   ARLSDYGVQLREKQKVRRIYGVLEKQFRNYYRDAARQKGNTGENLLQLLEGRLDNVVYR
FT                   MGFGATRAESRQLVSHKAIMVNGRVVNIPSFQVSPEDVICVREKAKKQARIKASLEVAG
FT                   QREKPTWVEVDAAKMEGAFKRLPERSDLSADINEQLIVELYSK"
     MARYIGPKLK LSRREGTDLF LKSGVRAIDS KCKIDTVPGQ HGARKARLSD YGVQLREKQK        60
     VRRIYGVLEK QFRNYYRDAA RQKGNTGENL LQLLEGRLDN VVYRMGFGAT RAESRQLVSH       120
     KAIMVNGRVV NIPSFQVSPE DVICVREKAK KQARIKASLE VAGQREKPTW VEVDAAKMEG       180
     AFKRLPERSD LSADINEQLI VELYSK                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page