(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSJ

CP000462.RPSJ        Location/Qualifiers
FT   CDS             335374..335778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="AHA_0308"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39221"
FT                   /db_xref="GOA:A0KF20"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF20"
FT                   /protein_id="ABK39221.1"
FT                   /translation="MGGNVKNHTSGGSNLGRAVLIYVLLSIGALSMQNQRIRIRLKAFD
FT                   HRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHKRL
FT                   VDIVEPTDKTVDALMRLDLAAGVDVQISLG"
     MGGNVKNHTS GGSNLGRAVL IYVLLSIGAL SMQNQRIRIR LKAFDHRLID QSTAEIVETA        60
     KRTGAQVRGP IPLPTRKERF TVLISPHVNK DARDQYEIRT HKRLVDIVEP TDKTVDALMR       120
     LDLAAGVDVQ ISLG                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page