(data stored in ACNUC7421 zone)

EMBL: CP000462.RPSK

CP000462.RPSK        Location/Qualifiers
FT   CDS             346599..346988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="AHA_0331"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38687"
FT                   /db_xref="GOA:A0KF43"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF43"
FT                   /protein_id="ABK38687.1"
FT                   /translation="MAKTPTRARKRVKKQVSDGIAHVHASFNNTIVTITDRQGNALSWA
FT                   TSGGSGFRGSRKSTPFAAQVAAERAGEIAKEYGVKNLEVMVKGPGPGRESSIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
     MAKTPTRARK RVKKQVSDGI AHVHASFNNT IVTITDRQGN ALSWATSGGS GFRGSRKSTP        60
     FAAQVAAERA GEIAKEYGVK NLEVMVKGPG PGRESSIRAL NAAGFRITNI TDVTPIPHNG       120
     CRPPKKRRV                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page